missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POU2F3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21362-25ul
This item is not returnable.
View return policy
Description
POU2F3 Polyclonal antibody specifically detects POU2F3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| POU2F3 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Epoc-1, MGC126698, oct-11, OCT11FLJ40063, Octamer-binding protein 11, Octamer-binding transcription factor 11, OTF11, OTF-11, PLA1, PLA-1, POU class 2 homeobox 3, POU domain class 2, transcription factor 3, POU domain, class 2, transcription factor 3, POU transcription factor, Skn-1a, Transcription factor PLA-1, Transcription factor Skn-1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYL | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunocytochemistry | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 25833 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction