missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PORCN Antibody, Novus Biologicals™

PORCN Antibody, Novus Biologicals™

Product Code. 30226917 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30226917 100 μL 100µL
30231872 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30226917 Supplier Novus Biologicals Supplier No. NBP335234100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PORCN Polyclonal antibody specifically detects PORCN in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PORCN
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias 2410004O13Rik, DHOF, EC 2.3.1.-, FODH, MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine, por, PORCMGC29687, porcupine homolog (Drosophila), Protein MG61
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1).,, Sequence:, PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 64840
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.