POP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18423961	Novus Biologicals NBP1-92282-25ul	25 μL

Description

POP7 Polyclonal specifically detects POP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POP7
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 0610037N12Rik, EC 3.1.26.5, hPOP7, processing of precursor 7, ribonuclease P subunit, processing of precursor 7, ribonuclease P subunit (S. cerevisiae), processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p20, Ribonucleases P/MRP protein subunit POP7 homolog, RNaseP protein p20, RPP20S. cerevisiae) homolog
• Gene Symbols: POP7
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10248
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only