POP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18434851	Novus Biologicals NBP1-92281-25ul	25 μL

Description

POP4 Polyclonal specifically detects POP4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POP4
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10775
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: EC 3.1.26.5, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p29, RPP29hPOP4
• Gene Symbols: POP4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only