POMZP3 Antibody (2E7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00022932-M02

Product Code. 18328268

Description

POMZP3 Monoclonal antibody specifically detects POMZP3 in Human, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA

Specifications

• Antigen: POMZP3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: MGC8359, POM (POM121 rat homolog) and ZP3 fusion, POM121 and ZP3 fusion, POM121 and ZP3 fusion protein, POM121/ZP3 fusion protein, rat) and ZP3 fusion
• Immunogen: POMZP3 (NP_694537, 64 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNM*
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
• Clone: 2E7
• Dilution: Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA
• Gene Accession No.: NP_694537
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22932
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ