missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POMT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£281.00 - £417.00
Specifications
| Antigen | POMT1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18275052
|
Novus Biologicals
NBP2-57200 |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18621718
|
Novus Biologicals
NBP2-57200-25ul |
25 μL |
£281.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
POMT1 Polyclonal specifically detects POMT1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| POMT1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Dolichyl-phosphate-mannose--protein mannosyltransferase 1, EC 2.4.1, EC 2.4.1.109, FLJ37239, LGMD2K, MDDGA1, MDDGB1, MDDGC1, protein O-mannosyl-transferase 1, protein-O-mannosyltransferase 1, RT | |
| POMT1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10585 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title