missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POMK/SGK196 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
POMK/SGK196 Polyclonal specifically detects POMK/SGK196 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ23356, MGC126597, protein kinase-like protein SgK196, Sugen kinase 196 | |
| Synthetic peptides corresponding to FLJ23356(hypothetical protein FLJ23356) The peptide sequence was selected from the N terminal of FLJ23356. Peptide sequence CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| 84197 | |
| IgG | |
| 40 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title