missing translation for 'onlineSavingsMsg'
Learn More

Poly-Ubiquitin Rabbit anti-Human, Mouse, Rat, Clone: 5Y8J0, Novus Biologicals™

Product Code. 18321976 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18321976 20 μg 20µL
18086115 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18321976 Supplier Novus Biologicals Supplier No. NBP31623220UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Poly-Ubiquitin Monoclonal antibody specifically detects Poly-Ubiquitin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Poly-Ubiquitin
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 5Y8J0
Conjugate Unconjugated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CEP80, HEL112, ribosomal protein S27a, RPS27A, S27A, UBA80, UBC, UBCEP1, UBCEP80
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of K48-linkage Specific Ubiquitin (P0CG47).,, Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6233
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.