POLR3K Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94027-0.02ml

Product Code. 18679551

Description

POLR3K Polyclonal antibody specifically detects POLR3K in Human samples. It is validated for Western Blot

Specifications

• Antigen: POLR3K
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: C11, DNA-directed RNA polymerase III subunit K, DNA-directed RNA polymerase III subunit RPC10, DNA-directed RNA polymerases III 12.5 kDa polypeptide, hRPC11, HsC11p, polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa), polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa, RNA polymerase III 12.5 kDa subunit, RNA polymerase III subunit (hRPC11), RNA polymerase III subunit C10, RNA polymerase III subunit C11, RNA polymerase III subunit CII, RPC10, RPC11C11-RNP3, RPC12.5
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3). MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
• Quantity: 0.02 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51728
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified