POLR3D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49556

Product Code. 18606808

Description

POLR3D Polyclonal antibody specifically detects POLR3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: POLR3D
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: BN51, BN51 (BHK21) temperature sensitivity complementing, BN51TDNA-directed RNA polymerase III 47 kDa polypeptide, DNA-directed RNA polymerase III subunit D, DNA-directed RNA polymerase III subunit RPC4, polymerase (RNA) III (DNA directed) polypeptide D, 44kDa, Protein BN51, RNA polymerase III 47 kDa subunit, RNA polymerase III subunit C4, RPC4, RPC53 homolog, temperature sensitive complementation, cell cycle specific, tsBN51, TSBN51RPC53
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 661
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG