missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18379499

POLR2L Antibody, Novus Biologicals™

Product Code. 18379499 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18379499 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18379499 Supplier Novus Biologicals Supplier No. H00005441D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

POLR2L Polyclonal antibody specifically detects POLR2L in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen POLR2L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_066951.1
Gene Alias DNA-directed RNA polymerase III subunit L, DNA-directed RNA polymerases I, II, and III subunit RPABC5, EC 2.7.7.6, hRPB7.6, hsRPB10b, polymerase (RNA) II (DNA directed) polypeptide L (7.6kD), polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa, RBP10, RNA polymerase II 7.6 kDa subunit, RPABC5, RPB10, RPB10 homolog, RPB10beta, RPB7.6RNA polymerases I, II, and III subunit ABC5
Host Species Rabbit
Immunogen POLR2L (NP_066951.1, 1 a.a. - 67 a.a.) full-length human protein. MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA Repair, DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 5441
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.