missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18345659

Novus Biologicals™ POLR1D Antibody, Novus Biologicals™

Product Code. 18345659 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18345659 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18345659 Supplier Novus Biologicals™ Supplier No. H00051082B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

POLR1D Polyclonal antibody specifically detects POLR1D in Human samples. It is validated for Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen POLR1D
Applications Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_057056.1
Gene Alias AC19, DNA-directed RNA polymerase I subunit D, DNA-directed RNA polymerases I and III subunit RPAC2, FLJ20616, hRPA19, MGC9850, POLR1C, polymerase (RNA) I polypeptide D, 16kDa, RPA16RNA polymerase I 16 kDa subunit, RPA9, RPAC2RNA polymerases I and III subunit AC2, RPC16, RPO1-3, TCS2
Host Species Mouse
Immunogen POLR1D (NP_057056.1, 1 a.a. - 133 a.a.) full-length human protein. MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Purification Method Protein G purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51082
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.