missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POLR1C Antibody, Novus Biologicals™

POLR1C Antibody, Novus Biologicals™

Product Code. 18404871 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18404871 25 μL 25µL
18431051 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18404871 Supplier Novus Biologicals Supplier No. NBP18711425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

POLR1C Polyclonal antibody specifically detects POLR1C in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen POLR1C
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias AC40, DNA-directed RNA polymerase I subunit C, DNA-directed RNA polymerases I and III 40 kDa polypeptide, POLR1E, polymerase (RNA) I polypeptide C, 30kDa, RNA polymerase I subunit, RPA39RNA polymerases I and III subunit AC1, RPA40TCS3, RPA5RPAC1DNA-directed RNA polymerases I and III subunit RPAC1, RPC40
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHD
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 9533
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.