Invitrogen™ POLI Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595515

Product Code. 16314785

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human placenta tissue, human A549 whole cell, human SK-OV-3 whole cell, rat testis tissue, rat testis tissue, rat kidney tissue, rat stomach tissue, mouse testis tissue, mouse testis tissue, mouse kidney tissue, mouse stomach tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity.

Specifications

• Antigen: POLI
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Poli
• Gene Alias: DNA polymerase iota; eta2; Poli; polymerase (DNA directed) iota; polymerase (DNA directed), iota; polymerase (DNA) iota; polymerase (DNA-directed), iota; RAD 30B; RAD30; RAD30 homolog B; RAD30B; RAD3OB
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11201, 26447, 291526
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q6R3M4, Q9UNA4
• Gene Symbols: Poli
• Immunogen: A synthetic peptide corresponding to a sequence of human DNA Polymerase iota (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG