missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POFUT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | POFUT2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
POFUT2 Polyclonal specifically detects POFUT2 in Human samples. It is validated for Western Blot.Specifications
| POFUT2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| C21orf80, chromosome 21 open reading frame 80, FUT13EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, O-FucT-2, Peptide-O-fucosyltransferase 2, protein O-fucosyltransferase 2 | |
| POFUT2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Y2G5 | |
| 23275 | |
| Synthetic peptides corresponding to POFUT2(protein O-fucosyltransferase 2) The peptide sequence was selected from the N terminal of POFUT2. Peptide sequence GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title