missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18346119

Novus Biologicals™ PNUTS/PPP1R10 Antibody (1D6), Novus Biologicals™

Product Code. 18346119 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346119 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346119 Supplier Novus Biologicals™ Supplier No. H00005514M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

PNUTS/PPP1R10 Monoclonal antibody specifically detects PNUTS/PPP1R10 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PNUTS/PPP1R10
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002705
Gene Alias CAT53, FB19PP1-binding protein of 114 kDa, MHC class I region proline-rich protein CAT53, p99, Phosphatase 1 nuclear targeting subunit, phosphatase nuclear targeting subunit, PNUTSPP1R10, Protein FB19, protein phosphatase 1 regulatory subunit 10, protein phosphatase 1, regulatory (inhibitor) subunit 10, protein phosphatase 1, regulatory subunit 10, serine/threonine-protein phosphatase 1 regulatory subunit 10
Host Species Mouse
Immunogen PPP1R10 (NP_002705.2, 1 a.a. ∽ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cellular Markers, Protein Phosphatase
Primary or Secondary Primary
Gene ID (Entrez) 5514
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.