missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PNMA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | PNMA1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PNMA1 Polyclonal specifically detects PNMA1 in Human samples. It is validated for Western Blot.Specifications
| PNMA1 | |
| Polyclonal | |
| Rabbit | |
| Q8ND90 | |
| 9240 | |
| Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein, paraneoplastic antigen MA1, paraneoplastic neuronal antigen MA1 | |
| PNMA1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title