missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PNKD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£222.00 - £470.00
Specifications
| Antigen | PNKD |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18441351
|
Novus Biologicals
NBP1-88347-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18265656
|
Novus Biologicals
NBP1-88347 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PNKD Polyclonal specifically detects PNKD in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| PNKD | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 25953 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| BRP17FKSG19, DKFZp564N1362, DYT8paroxysmal nonkinesiogenic dyskinesia, FPD1brain protein 17, KIAA1184Myofibrillogenesis regulator 1, KIPP1184probable hydrolase PNKD, MGC31943, MR1Paroxysmal nonkinesiogenic dyskinesia protein, MR-1Trans-activated by hepatitis C virus core protein 2, paroxysmal nonkinesigenic dyskinesia, PDCEC 3.-, TAHCCP2PKND1 | |
| PNKD | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title