missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMM1/Phosphomannomutase 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17530-100UL
This item is not returnable.
View return policy
Description
PMM1/Phosphomannomutase 1 Polyclonal antibody specifically detects PMM1/Phosphomannomutase 1 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
| PMM1/Phosphomannomutase 1 | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| brain glucose-1,6-bisphosphatase, EC 5.4.2.8, phosphomannomutase 1, PMM 1, PMMH22, PMMH-22, Sec53 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA | |
| 100 μg | |
| Proteases & Other Enzymes | |
| 5372 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction