missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PMCA1 Polyclonal antibody specifically detects PMCA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | PMCA1 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 to 1:200, Immunohistochemistry-Paraffin 1:50 to 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | ATPase, Ca++ transporting, plasma membrane 1, EC 3.6.3, EC 3.6.3.8, plasma membrane calcium ATPase, Plasma membrane calcium ATPase isoform 1, plasma membrane calcium pump, Plasma membrane calcium pump isoform 1, plasma membrane calcium-ATPase, PMCA1kb, PMCA1plasma membrane calcium-transporting ATPase 1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIP |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?