missing translation for 'onlineSavingsMsg'
Learn More

PM20D1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18321706 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Quantity:
100 μg
25 μg
Packungsgröße:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18321706 25 μg 25µL
18397154 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18321706 Lieferant Novus Biologicals Lieferanten-Nr. NBP30987625UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

PM20D1 Polyclonal specifically detects PM20D1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen PM20D1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias Cps1, EC 3.4.17.-, FLJ32569, peptidase M20 domain containing 1, Peptidase M20 domain-containing protein 1, probable carboxypeptidase PM20D1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human PM20D1 (NP_689704). Peptide sequence SMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTT
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 148811
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.