PLK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18689115	Novus Biologicals NBP2-49014-25ul	25 μL
18646545	Novus Biologicals NBP2-49014	0.1 mL

Description

PLK1 Polyclonal antibody specifically detects PLK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PLK1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Mitotic Regulators, Stem Cell Markers
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene ID (Entrez): 5347
• Isotype: IgG
• Purification Method: Immunogen affinity purified

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: cell cycle regulated protein kinase, EC 2.7.11, EC 2.7.11.21, PLK, PLK-1, polo (Drosophia)-like kinase, polo like kinase, polo-like kinase 1polo-like kinase (Drosophila), Serine/threonine-protein kinase 13, serine/threonine-protein kinase PLK1, STPK13
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.