PLEKHO2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10197-100UL

Product Code. 18349704

Description

PLEKHO2 Polyclonal specifically detects PLEKHO2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PLEKHO2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DKFZp761K2312, FLJ38884, PH domain-containing family O member 2, PH domain-containing family Q member 1, PH domain-containing protein, pleckstrin homology domain containing, family O member 2, pleckstrin homology domain containing, family Q member 1, pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1, PLEKHQ1, PP1628, pp9099
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse PLEKHO2 (NP_694759.1). Peptide sequence LLRSPGNKVSDIKFQAPSGEEKESWIKALNEGINRGKNKAFDEVKVDKTC
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80301
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.