PLEKHB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68994

Product Code. 18671068

Description

PLEKHB2 Polyclonal antibody specifically detects PLEKHB2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PLEKHB2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: evectin-2, EVT2FLJ20783, FLJ23679, FLJ30436, PH domain-containing family B member 2, pleckstrin homology domain containing, family B (evectins) member 2, pleckstrin homology domain-containing family B member 2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55041
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified