PLEKHA3, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Marca:  Abnova H00065977-B01.50uL

Código de producto. 16163419

Descripción

Sequence: MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS

Especificaciones

• Antigen: PLEKHA3
• Classification: Polyclonal
• Formulation: No additive
• Gene Accession No.: NM_019091
• Gene Symbols: PLEKHA3
• Immunogen: PLEKHA3 (NP_061964, 1 a.a. ∼ 300 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 65977
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Gene: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
• Gene Alias: FAPP1/FLJ20067
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody