missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLEKHA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £417.00
Specifications
| Antigen | PLEKHA3 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18415940
|
Novus Biologicals
NBP1-83924-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18251288
|
Novus Biologicals
NBP1-83924 |
0.1 mL |
£417.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
PLEKHA3 Polyclonal specifically detects PLEKHA3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| PLEKHA3 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 65977 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| FAPP-1, FAPP1PH domain-containing family A member 3, FLJ20067, four-phosphate-adaptor protein 1, Phosphatidylinositol-four-phosphate adapter protein 1, Phosphoinositol 4-phosphate adapter protein 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 3, pleckstrin homology domain-containing family A member 3, pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 3 | |
| PLEKHA3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts