missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pleckstrin Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33224-20ul
This item is not returnable.
View return policy
Description
Pleckstrin Monoclonal antibody specifically detects Pleckstrin in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| Pleckstrin | |
| Monoclonal | |
| Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| FLJ27168, p47, P47Platelet 47 kDa protein, pleckstrin | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pleckstrin (P08567).,, Sequence:, MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAI | |
| 20 μL | |
| Signal Transduction | |
| 5341 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction