missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLCL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17912-100UL
This item is not returnable.
View return policy
Description
PLCL2 Polyclonal antibody specifically detects PLCL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PLCL2 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 3.1.4.11, FLJ13484, inactive phospholipase C-like protein 2, KIAA1092PLCE2, phospholipase C, epsilon 2, Phospholipase C-epsilon-2, Phospholipase C-L2, phospholipase C-like 2, PLC-epsilon-2, PLC-L(2), PLC-L2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE | |
| 100 μg | |
| Signal Transduction | |
| 23228 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction