Plasma Kallikrein/KLKB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58978

Product Code. 18255211

Description

Plasma Kallikrein/KLKB1 Polyclonal specifically detects Plasma Kallikrein/KLKB1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Plasma Kallikrein/KLKB1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.21, EC 3.4.21.34, Fletcher factor, kallikrein B, plasma (Fletcher factor) 1, kininogenin, KLK3plasma kallikrein, plasma kallikrein heavy chain, plasma kallikrein light chain, Plasma prekallikrein, PPK
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 79%.
• Target Species: Human, Rat, Pig, Canine, Equine
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P03952
• Gene Symbols: KLKB1
• Immunogen: Synthetic peptides corresponding to KLKB1(kallikrein B, plasma (Fletcher factor) 1) The peptide sequence was selected from the middle region of KLKB1. Peptide sequence VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3818
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only