missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLA2G4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PLA2G4B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PLA2G4B Polyclonal specifically detects PLA2G4B in Human samples. It is validated for Western Blot.Specifications
| PLA2G4B | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| FLJ20543, FLJ20656, FLJ20807, FLJ77014, FLJ78330, jmjC domain-containing protein 7, jumonji domain containing 7, Jumonji domain-containing protein 7 | |
| JMJD7-PLA2G4B | |
| IgG | |
| 114 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_005081 | |
| 8681 | |
| Synthetic peptide directed towards the N terminal of human PLA2G4B. Peptide sequence: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title