missing translation for 'onlineSavingsMsg'
Learn More

PLA2G16/HRASLS3 Antibody, Novus Biologicals™

Product Code. 18323209 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18323209 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18323209 Supplier Novus Biologicals Supplier No. H00011145D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PLA2G16/HRASLS3 Polyclonal antibody specifically detects PLA2G16/HRASLS3 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PLA2G16/HRASLS3
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. AAH01387.1
Gene Alias Adipose-specific phospholipase A2, AdPLAHRASLS3, EC 3.1.1.4, group XVI phospholipase A2, HRAS-like suppressor 3Ca-independent phospholipase A1/2, H-REV107-1, HREV107-3adipose-specific PLA2, HREV107H-rev 107 protein homolog, MGC118754, phospholipase A2, group XVI, Renal carcinoma antigen NY-REN-65
Host Species Rabbit
Immunogen HRASLS3 (AAH01387.1, 1 a.a. - 162 a.a.) full-length human protein. MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 11145
Target Species Human, Mouse
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.