missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PKNOX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35525-100ul
This item is not returnable.
View return policy
Description
PKNOX1 Polyclonal antibody specifically detects PKNOX1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| PKNOX1 | |
| Polyclonal | |
| Western Blot 1:200 - 1:2000, ELISA | |
| Homeobox protein PREP-1, PBX/kn10Pbx regulating protein-1, pkonx1c | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 322-436 of human PKNOX1 (NP_004562.2).,, Sequence:, LDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALAPAHISGLVLENSDSLQ | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 5316 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction