Invitrogen™ PKLR Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579824

Product Code. 15905395

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, rat liver tissue, mouse liver tissue. IHC: human intestinal cancer tissue.

The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: PKLR
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PKLR
• Gene Alias: isozymes R/L; L-PK; PK1; Pk-1; PKL; Pklg; Pklr; PKR; PKRL; Pyruvate kinase 1; pyruvate kinase isozyme R/L; pyruvate kinase isozymes L/R; pyruvate kinase isozymes R/L; pyruvate kinase liver and red blood cell; pyruvate kinase PKLR; pyruvate kinase type L; pyruvate kinase, liver and blood cell; pyruvate kinase, liver and RBC; pyruvate kinase, liver and red blood cell; red cell/liver pyruvate kinase; RPK; R-PK; R-type/L-type pyruvate kinase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 18770, 24651, 5313
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P12928, P30613, P53657
• Gene Symbols: PKLR
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG