missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ PKI-beta Antibody (7F8), Novus Biologicals™

Product Code. 18346688 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346688 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346688 Supplier Novus Biologicals™ Supplier No. H00005570M01100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

PKI-beta Monoclonal antibody specifically detects PKI-beta in Human samples. It is validated for ELISA,Western Blot,Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PKI-beta
Applications ELISA, Western Blot, Sandwich ELISA
Classification Monoclonal
Clone 7F8
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, ELISA 1:100-1:2000, Sandwich ELISA 1:100-1:2000
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_115860.1
Gene Alias cAMP-dependent protein kinase inhibitor 2, cAMP-dependent protein kinase inhibitor beta, FLJ23817, PKI-beta, PRKACN2, protein kinase (cAMP-dependent, catalytic) inhibitor beta
Host Species Mouse
Immunogen PKIB (NP_115860.1, 2 a.a. ∽ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSV
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5570
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.