missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18433589

PKHD1L1 Antibody (1F5), Novus Biologicals™

Product Code. 18433589 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18433589 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18433589 Supplier Novus Biologicals Supplier No. H00093035M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

PKHD1L1 Monoclonal antibody specifically detects PKHD1L1 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PKHD1L1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1F5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_803875
Gene Alias DKFZp586C1021, fibrocystin L, fibrocystin-L, PKHD1-like protein 1, PKHDL1, polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1, Polycystic kidney and hepatic disease 1-like protein 1, polycystic kidney and hepatic disease-like 1
Host Species Mouse
Immunogen PKHD1L1 (NP_803875, 4105 a.a. ∽ 4186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KATDSDGNCVSVGITALTLRAILKDSNNNQVNGLSGNTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVGVESRTFSLLA
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93035
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.