missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PKC gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PKC gamma |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PKC gamma Polyclonal specifically detects PKC gamma in Human samples. It is validated for Western Blot.Specifications
| PKC gamma | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
| EC 2.7.11, EC 2.7.11.13, MGC57564, PKCCSCA14, PKC-gamma, PKCGprotein kinase C gamma type, protein kinase C, gamma | |
| PRKCG | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P05129 | |
| 5582 | |
| Synthetic peptides corresponding to PRKCG(protein kinase C, gamma) The peptide sequence was selected from the middle region of PRKCG. Peptide sequence WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title