PKA 2 beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17753-25UL

Product Code. 18313105

Description

PKA 2 beta Polyclonal antibody specifically detects PKA 2 beta in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: PKA 2 beta
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: cAMP-dependent protein kinase type II-beta regulatory chain, cAMP-dependent protein kinase type II-beta regulatory subunit, H_RG363E19.2, PRKAR2, protein kinase, cAMP-dependent, regulatory, type II, beta, RII-BETA, WUGSC:H_RG363E19.2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI
• Quantity: 25 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5577
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified