missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PITX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | PITX2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18215563
|
Novus Biologicals
NBP2-55572 |
100 μL |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18655697
|
Novus Biologicals
NBP2-55572-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PITX2 Polyclonal specifically detects PITX2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PITX2 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5308 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin | |
| PITX2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title