missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18362799

PITX2 Antibody, Novus Biologicals™

Product Code. 18362799 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18362799 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18362799 Supplier Novus Biologicals Supplier No. H00005308D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PITX2 Polyclonal antibody specifically detects PITX2 in Human samples. It is validated for Western Blot, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen PITX2
Applications Western Blot, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_700476.1
Gene Alias all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin
Host Species Rabbit
Immunogen PITX2 (NP_700476.1, 1 a.a. - 271 a.a.) full-length human protein. METNCRKLVSACVQLEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5308
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.