missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PITPN Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£169.00 - £385.00
Specifications
| Antigen | PITPN |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18664262
|
Novus Biologicals
NBP2-94205-0.02ml |
0.02 mL |
£169.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18638022
|
Novus Biologicals
NBP2-94205-0.1ml |
0.1 mL |
£385.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PITPN Polyclonal antibody specifically detects PITPN in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| PITPN | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Vision | |
| PBS (pH 7.3), 50% glycerol | |
| 5306 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| MGC99649, phosphatidylinositol transfer protein alpha isoform, phosphatidylinositol transfer protein, alpha, PI-TPalpha, PI-TP-alpha, PITPNphosphotidylinositol transfer protein, PtdIns transfer protein alpha, PtdInsTP alpha, VIB1A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1). NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title