missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pirh2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | Pirh2 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18467421
|
Novus Biologicals
NBP1-90098-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18297296
|
Novus Biologicals
NBP1-90098 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pirh2 Polyclonal specifically detects Pirh2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Pirh2 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Androgen receptor N-terminal-interacting protein, androgen-receptor N-terminal-interacting protein, ARNIPRING finger protein 199, CHIMPRNF199DKFZp586C1620, CH-rich interacting match with PLAG1, CH-rich-interacting match with PLAG1, E3 ubiquitin-protein ligase Pirh2, EC 6.3.2.-, hARNIP, hPirh2, PIRH2, PRO1996, ring finger and CHY zinc finger domain containing 1, RING finger and CHY zinc finger domain-containing protein 1, Zinc finger protein 363p53-induced RING-H2 protein, ZNF363 | |
| RCHY1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Breast Cancer, Cancer, p53 Pathway, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 25898 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title