missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Pipecolic acid oxidase Monoclonal antibody specifically detects Pipecolic acid oxidase in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Specifications
Specifications
| Antigen | Pipecolic acid oxidase |
| Applications | Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation |
| Classification | Monoclonal |
| Clone | 3D1 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | EC 1.5.3.1, EC 1.5.3.7, L-pipecolate oxidase, L-pipecolic acid oxidase, LPIPOXperoxisomal sarcosine oxidase, pipecolic acid oxidase, PSO |
| Host Species | Mouse |
| Immunogen | PIPOX (AAH27622.1, 292 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?