Pinin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35710-20ul

Product Code. 30230860

Description

Pinin Polyclonal antibody specifically detects Pinin in Human,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: Pinin
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: 140 kDa nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, DRS protein, DRSP, DRSSR-like protein, Melanoma metastasis clone A protein, MEMA, neutrophil protein, Nuclear protein SDK3, pinin, pinin, desmosome associated protein, SDK3
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pinin (NP_002678.2).,, Sequence:, MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5411
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG