missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIN/DLC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PIN/DLC8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PIN/DLC8 Polyclonal specifically detects PIN/DLC8 in Human samples. It is validated for Western Blot.Specifications
| PIN/DLC8 | |
| Polyclonal | |
| Rabbit | |
| p53 Pathway | |
| cytoplasmic dynein light polypeptide, DLC1DNCLC1, DLC8MGC126137, DNCL1MGC126138, dynein light chain 1, cytoplasmic, Dynein light chain LC8-type 1, dynein, cytoplasmic, light polypeptide 1, dynein, light chain, LC8-type 1,8 kDa dynein light chain, hdlc1, LC8, PINLC8a, Protein inhibitor of neuronal nitric oxide synthase | |
| DYNLL1 | |
| IgG | |
| 10 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P63167 | |
| 8655 | |
| Synthetic peptides corresponding to DYNLL1(dynein, light chain, LC8-type 1) The peptide sequence was selected from the N terminal of DYNLL1. Peptide sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title