missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PILR-alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PILR-alpha |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PILR-alpha Polyclonal specifically detects PILR-alpha in Human samples. It is validated for Western Blot.Specifications
| PILR-alpha | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q9UKJ1-4 | |
| 29992 | |
| Synthetic peptides corresponding to PILRA(paired immunoglobin-like type 2 receptor alpha) The peptide sequence was selected from the N terminal of PILRA. Peptide sequence IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-like type 2 receptor alpha | |
| PILRA | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title