PIK3R5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57055

Product Code. 18248101

Description

PIK3R5 Polyclonal specifically detects PIK3R5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PIK3R5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: F730038I15Rik, FOAP-2, p101, P101-PI3K, Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit, phosphoinositide-3-kinase, regulatory subunit 5, phosphoinositide-3-kinase, regulatory subunit, polypeptide p101, PI3-kinase p101 subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, regulatory subunit 5, p101
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23533
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PIK3R5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only