missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIK3CA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | PIK3CA |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232337
|
Novus Biologicals
NBP3-35708-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227928
|
Novus Biologicals
NBP3-35708-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PIK3CA Polyclonal antibody specifically detects PIK3CA in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| PIK3CA | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Diabetes Research, mTOR Pathway, Oncogenes | |
| PBS (pH 7.3), 50% glycerol | |
| 5290 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 2.7.1, EC 2.7.1.153, MGC142161, MGC142163, p110-alpha, Phosphatidylinositol 3-Kinase catalytic subunit alpha, phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha, phosphatidylinositol 3-kinase, catalytic, alpha polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, alpha isoform, phosphoinositide-3-kinase, catalytic, alpha polypeptide, PI3K, PI3K-alpha, PI3-kinase p110 subunit alpha, PI3-kinase subunit alpha, PtdIns-3-kinase p110, PtdIns-3-kinase subunit alpha, PtdIns-3-kinase subunit p110-alpha | |
| A synthetic peptide corresponding to a sequence within amino acids 401-600 of human PIK3CA (NP_006209.2).,, Sequence:, ERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title