missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIGW Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | PIGW |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PIGW Polyclonal specifically detects PIGW in Rat samples. It is validated for Western Blot.Specifications
| PIGW | |
| Polyclonal | |
| Rabbit | |
| NP_919443 | |
| 284098 | |
| Synthetic peptide directed towards the middle region of human PigwThe immunogen for this antibody is Pigw. Peptide sequence SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| class W, EC 2.3, FLJ37433, phosphatidylinositol glycan anchor biosynthesis, class W, PIG-W | |
| PIGW | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title