missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIGU Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35867-20ul
This item is not returnable.
View return policy
Description
PIGU Polyclonal antibody specifically detects PIGU in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| PIGU | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| bA346K17.2, CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1, CDC91L1CDC91 cell division cycle 91-like 1 (S. cerevisiae), cell division cycle 91-like 1 protein, Cell division cycle protein 91-like 1, GAB1, GPI transamidase component PIG-U, GPI transamidase subunit, MGC40420, phosphatidylinositol glycan anchor biosynthesis class U protein, phosphatidylinositol glycan anchor biosynthesis, class U, Protein CDC91-like 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIGU (NP_536724.1).,, Sequence:, MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQ | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 128869 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction