PIGT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69585

Product Code. 18242043

Description

PIGT Polyclonal specifically detects PIGT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIGT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ41596, GPI transamidase component PIG-T, GPI transamidase subunit, MGC8909, NDAP, neurotrophin-regulated neuronal development-associated protein, phosphatidyl inositol glycan class T, phosphatidylinositol glycan anchor biosynthesis, class T, phosphatidylinositol glycan, class T, Phosphatidylinositol-glycan biosynthesis class T protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 64 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q969N2
• Gene Symbols: PIGT
• Immunogen: Synthetic peptides corresponding to PIGT(phosphatidylinositol glycan anchor biosynthesis, class T) The peptide sequence was selected from the N terminal of PIGT. Peptide sequence PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51604
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only